EMC-Logo Order form "Microbial and antimicrobial peptides"
➔ Back to Order Forms
For product information, please download our ➔ EMC Biochemicals Catalogue
Code Product Purity Unit Quantity Price per unit (Euro)*
AMP-001 α-Defensin 5 human:
ATCYCRTGRCATRESLSGVCEISGRLYRLCCR
Disulfide bridges: 3 – 31, 5 – 20, 10 – 30
≥ 95 % 0.1 mg
    ≥ 95 % 1 mg
AMP-010 Histatin 5: DSHAKRHHGYKRKFHEKHHSHRGY ≥ 70 % 5 mg

    ≥ 95 % 1 mg
    ≥ 95 % 5 mg
AMP-020 Indolicidin: ILPWKWPWWPWRR-NH2 ≥ 70 % 5 mg
    ≥ 95 % 1 mg
    ≥ 95 % 5 mg
AMP-030 LL-37 human: [LL-37, 37 aa] ≥ 70 % 5 mg
    ≥ 95 % 1 mg
    ≥ 95 % 5 mg
AMP-040 Magainin-1: GIGKFLHSAGKFGKAFVGEIMKS ≥ 70 % 5 mg
    ≥ 95 % 1 mg
    ≥ 95 % 5 mg
AMP-050 Pep27: MRKEFHNVLSSGQLLADKRPARDYNRK ≥ 70 % 5 mg
    ≥ 95 % 1 mg
    ≥ 95 % 5 mg
AMP-055 Dermcidin DCD-1L:
SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
≥ 95 % 1 mg
    ≥ 95 % 5 mg
AMP-056 Dermcidin DCD-1:
SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSV
≥ 95 % 1 mg
    ≥ 95 % 5 mg
AMP-057 Dermcidin SSL25:
SSLLEKGLDGAKKAVGGLGKLGKDA
≥ 95 % 1 mg
    ≥ 95 % 5 mg
AMP-060 Alamethicin F30: Ac-Aib-Pro-Aib-Ala-Aib-Ala-Gln-
Aib-Val-Aib-Gly-Leu-Aib-Pro-Val-Aib-Aib-Glu-Gln-Pheol
(Pheol = Phenylalaninol)
≥ 70 % 1 mg
    ≥ 70 % 5 mg
    ≥ 95 % 1 mg
    ≥ 95 % 5 mg
AMP-061 Alamethicin F50: Ac-Aib-Pro-Aib-Ala-Aib-Ala-Gln-
Aib-Val-Aib-Gly-Leu-Aib-Pro-Val-Aib-Aib-Gln-Gln-Pheol
(Pheol = Phenylalaninol)
≥ 70 % 1 mg
    ≥ 70 % 5 mg
    ≥ 95 % 1 mg
    ≥ 95 % 5 mg
AMP-065 Omphalotin A: c[Trp-MeVal-Ile-MeVal-MeVal-Sar-MeVal-MeIle-Sar-Val-MeIle-Sar] ≥ 70 % 1 mg
    ≥ 70 % 5 mg
    ≥ 95 % 1 mg
    ≥ 95 % 5 mg
AMP-070 Gallidermin, structure see catalogue ≥ 85 % 1 mg
    ≥ 85 % 5 mg
AMP-075 Nonactin, structure see catalogue
≥ 85 % 1 mg
    ≥ 85 % 5 mg
AMP-090 Actagardin, structure see catalogue
≥ 85 % 1 mg
    ≥ 85 % 5 mg
MP-010 S. epidermidis Pheromone Peptide, structure see catalogue
≥ 95 % 0.5 mg
    ≥ 95 % 1 mg

 
Name


Company/University

 
Department/Institute

 
Address

 
City

 
Postal Code

 
Country

 
Phone


Fax

 
Additional message

 
e-mail-address

 
*Prices are exclusive VAT and shipping costs.