EMC-Logo Order form "Bioactive Peptides"
Amyloid-β peptides


➔ Back to Order Forms · For product information, please download our ➔ EMC Biochemicals Catalogue
Code Product Purity Unit Quantity Price per unit (Euro)*
Amyloid-β peptides
BAP-012 Amyloid-β (1-40) human:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
≥ 95 % 1 mg
    ≥ 95 % 5 mg
BAP-013 Amyloid-β (1-40) human HCl salt:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
≥ 95 % 1 mg
    ≥ 95 % 5 mg
BAP-014 Amyloid-β (1-40) rat:
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
≥ 95 % 1 mg
    ≥ 95 % 5 mg
BAP-015 Amyloid-β (1-40) rat HCl salt:
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
≥ 95 % 1 mg
    ≥ 95 % 5 mg
BAP-016 Aη 46-peptide
ADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKM
≥ 95 % 1 mg
    ≥ 95 % 5 mg
Reverse control peptides of amyloid-β peptides
BAP-022 Control peptide amyloid-β (40-1) human:
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
≥ 95 % 1 mg
    ≥ 95 % 5 mg
BAP-023 Control peptide amyloid-β (40-1) rat:
VVGGVMLGIIAGKNSGVDEAFFVLKQHRVEFGSDHGFEAD
≥ 95 % 1 mg
    ≥ 95 % 5 mg
Biotinylated amyloid-β peptides
BAP-031 Biotinylated amyloid-β (1-40) human:
Biotin-Aca-Aca-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
≥ 95 % 1 mg
    ≥ 95 % 5 mg
BAP-032 Biotinylated amyloid-β (1-40) rat:
Biotin-Aca-Aca-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
≥ 95 % 1 mg
    ≥ 95 % 5 mg
Peptides as inhibitors of amyloid-β
BAP-041 KLVFF ≥ 70 % 5 mg
    ≥ 95 % 1 mg
    ≥ 95 % 5 mg
BAP-042 Ac-KLVFF-NH2 ≥ 70 % 5 mg
    ≥ 95 % 1 mg
    ≥ 95 % 5 mg
BAP-043 RIIGL ≥ 70 % 5 mg
    ≥ 95 % 1 mg
    ≥ 95 % 5 mg
BAP-044 DWGKGGRWRLWPGASGKTEA ≥ 70 % 5 mg
    ≥ 95 % 1 mg
    ≥ 95 % 5 mg
BAP-045 PGRSPFTGKKLFNQEFSQDQ ≥ 70 % 5 mg
    ≥ 95 % 1 mg
    ≥ 95 % 5 mg
BAP-046 qshyrhispaqv (D-amino acids) ≥ 95 % 1 mg
    ≥ 95 % 5 mg
BAP-047 FYLKVPSSLHHHHGRDKLVFFHHHH ≥ 70 % 5 mg
    ≥ 95 % 1 mg
    ≥ 95 % 5 mg
BAP-048 NYSKMIFSHHHH ≥ 70 % 5 mg
    ≥ 95 % 1 mg
    ≥ 95 % 5 mg
BAP-049 HNHKLVFFHHQH ≥ 70 % 5 mg
    ≥ 95 % 1 mg
    ≥ 95 % 5 mg

 
Name


Company/University

 
Department/Institute

 
Address

 
City

 
Postal Code

 
Country

 
Phone


Fax

 
Additional message

 
e-mail-address

 
*Prices are exclusive VAT and shipping costs.